Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3F9F2

Protein Details
Accession A0A0C3F9F2    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
93-116PIRETFSKRRGDKRLKEEKVRFDSBasic
NLS Segment(s)
PositionSequence
100-107KRRGDKRL
Subcellular Location(s) cyto 14, cyto_nucl 13, nucl 10
Family & Domain DBs
Amino Acid Sequences MNSVIDLYKDILRAVEDLSTCPYTSEVFSELLAKIQAAIDRLNLEGYANLEHWVAELDKRIGGILLQHLVHIIKVWCAEFDRTDDGDMRRDAPIRETFSKRRGDKRLKEEKVRFDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.12
4 0.13
5 0.17
6 0.18
7 0.17
8 0.16
9 0.16
10 0.14
11 0.14
12 0.15
13 0.12
14 0.12
15 0.12
16 0.13
17 0.13
18 0.12
19 0.12
20 0.1
21 0.08
22 0.09
23 0.09
24 0.08
25 0.09
26 0.09
27 0.09
28 0.1
29 0.09
30 0.08
31 0.07
32 0.07
33 0.07
34 0.07
35 0.07
36 0.07
37 0.07
38 0.07
39 0.07
40 0.07
41 0.06
42 0.06
43 0.07
44 0.07
45 0.07
46 0.07
47 0.07
48 0.06
49 0.06
50 0.06
51 0.06
52 0.07
53 0.07
54 0.07
55 0.08
56 0.08
57 0.08
58 0.08
59 0.07
60 0.07
61 0.08
62 0.08
63 0.08
64 0.1
65 0.12
66 0.11
67 0.14
68 0.17
69 0.17
70 0.18
71 0.21
72 0.21
73 0.24
74 0.24
75 0.22
76 0.2
77 0.22
78 0.21
79 0.23
80 0.28
81 0.31
82 0.36
83 0.42
84 0.46
85 0.51
86 0.6
87 0.61
88 0.65
89 0.69
90 0.73
91 0.76
92 0.8
93 0.84
94 0.84
95 0.88
96 0.87