Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3G8B7

Protein Details
Accession A0A0C3G8B7    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
55-80QLPPQAKTIKSKKRKASSKSTSKKTSHydrophilic
NLS Segment(s)
PositionSequence
62-78TIKSKKRKASSKSTSKK
Subcellular Location(s) nucl 17, cyto_nucl 10.5, mito 8
Family & Domain DBs
Amino Acid Sequences MVRMDNHLLRLKRTTRPGLGSSASGNNGENGQPPPTEEYDEVGSSAGDNNGENGQLPPQAKTIKSKKRKASSKSTSKKTSASAKVNEGATEPSVKRQKWQAH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.52
3 0.55
4 0.54
5 0.51
6 0.47
7 0.41
8 0.36
9 0.31
10 0.27
11 0.22
12 0.2
13 0.16
14 0.15
15 0.14
16 0.14
17 0.13
18 0.13
19 0.12
20 0.13
21 0.15
22 0.16
23 0.18
24 0.15
25 0.16
26 0.16
27 0.16
28 0.15
29 0.12
30 0.11
31 0.08
32 0.08
33 0.06
34 0.05
35 0.05
36 0.05
37 0.05
38 0.06
39 0.06
40 0.06
41 0.06
42 0.09
43 0.09
44 0.09
45 0.12
46 0.15
47 0.15
48 0.23
49 0.33
50 0.4
51 0.5
52 0.58
53 0.65
54 0.73
55 0.81
56 0.8
57 0.81
58 0.81
59 0.82
60 0.83
61 0.83
62 0.79
63 0.73
64 0.69
65 0.64
66 0.63
67 0.6
68 0.58
69 0.54
70 0.51
71 0.53
72 0.5
73 0.45
74 0.37
75 0.3
76 0.24
77 0.26
78 0.22
79 0.27
80 0.34
81 0.34
82 0.38