Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3BNZ8

Protein Details
Accession A0A0C3BNZ8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
6-29QSIVLVRRTSRRARRERRPVVEDSHydrophilic
NLS Segment(s)
PositionSequence
16-22RRARRER
Subcellular Location(s) mito 24, cyto 2
Family & Domain DBs
Amino Acid Sequences MYPAAQSIVLVRRTSRRARRERRPVVEDSTNARRVRFQIALPFMGNIPGVPFQIHDFVFWWEESVVSYGYITAFSRMSDFVDPFFA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.5
3 0.55
4 0.63
5 0.72
6 0.81
7 0.85
8 0.89
9 0.88
10 0.84
11 0.78
12 0.73
13 0.67
14 0.59
15 0.53
16 0.5
17 0.48
18 0.43
19 0.39
20 0.34
21 0.32
22 0.34
23 0.3
24 0.24
25 0.24
26 0.25
27 0.26
28 0.24
29 0.23
30 0.17
31 0.16
32 0.14
33 0.08
34 0.07
35 0.06
36 0.06
37 0.06
38 0.07
39 0.07
40 0.1
41 0.11
42 0.1
43 0.1
44 0.12
45 0.13
46 0.12
47 0.12
48 0.09
49 0.09
50 0.1
51 0.1
52 0.09
53 0.07
54 0.08
55 0.07
56 0.07
57 0.08
58 0.08
59 0.09
60 0.08
61 0.09
62 0.11
63 0.11
64 0.14
65 0.16
66 0.16