Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3ALE8

Protein Details
Accession A0A0C3ALE8    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
8-36IIRHGYTNRFRKRKLYKFLRLKKNCVSHLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13.5, mito_nucl 12.833, nucl 11, cyto_nucl 7.333
Family & Domain DBs
Amino Acid Sequences MTLTPPSIIRHGYTNRFRKRKLYKFLRLKKNCVSHLIMTIIKLNDTHSAIRHPSPVCQSILQEKVIQIPTVEKKLRQSFNHDHYQLHDTHSAIRHPSSVTGMPIDFAREGYTNSYIIYVSTQGFESKMNSNRQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.63
3 0.7
4 0.71
5 0.74
6 0.78
7 0.79
8 0.8
9 0.8
10 0.81
11 0.84
12 0.91
13 0.92
14 0.88
15 0.85
16 0.83
17 0.8
18 0.72
19 0.66
20 0.61
21 0.51
22 0.47
23 0.43
24 0.35
25 0.27
26 0.28
27 0.22
28 0.18
29 0.16
30 0.15
31 0.14
32 0.15
33 0.16
34 0.13
35 0.16
36 0.18
37 0.19
38 0.23
39 0.2
40 0.21
41 0.24
42 0.26
43 0.24
44 0.23
45 0.23
46 0.23
47 0.25
48 0.23
49 0.2
50 0.17
51 0.19
52 0.19
53 0.18
54 0.12
55 0.14
56 0.15
57 0.2
58 0.21
59 0.18
60 0.25
61 0.32
62 0.38
63 0.36
64 0.43
65 0.45
66 0.5
67 0.58
68 0.52
69 0.45
70 0.42
71 0.43
72 0.35
73 0.3
74 0.27
75 0.18
76 0.21
77 0.23
78 0.22
79 0.2
80 0.2
81 0.18
82 0.17
83 0.18
84 0.17
85 0.16
86 0.16
87 0.16
88 0.15
89 0.14
90 0.14
91 0.15
92 0.11
93 0.1
94 0.11
95 0.1
96 0.12
97 0.15
98 0.16
99 0.14
100 0.15
101 0.15
102 0.13
103 0.12
104 0.13
105 0.11
106 0.1
107 0.11
108 0.11
109 0.11
110 0.12
111 0.13
112 0.15
113 0.21
114 0.27