Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3GBF9

Protein Details
Accession A0A0C3GBF9    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-27TLNQSVRCKPKPKKRYKAKAPLLENGPHydrophilic
36-55VFIMKPKKPNSAKRKVARVKHydrophilic
NLS Segment(s)
PositionSequence
9-22KPKPKKRYKAKAPL
40-53KPKKPNSAKRKVAR
Subcellular Location(s) nucl 10mito 10mito_nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR006032  Ribosomal_S12/S23  
IPR005679  Ribosomal_S12_bac  
Gene Ontology GO:0015935  C:small ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00164  Ribosom_S12_S23  
PROSITE View protein in PROSITE  
PS00055  RIBOSOMAL_S12  
CDD cd03368  Ribosomal_S12  
Amino Acid Sequences TLNQSVRCKPKPKKRYKAKAPLLENGPQRKGVVSQVFIMKPKKPNSAKRKVARVKLTSGKQTMAYIQGEGHNLQEHSVVLVRGGRAQDLPGVKYKLVRGAHDFGGVVNRMKSRSRYG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.94
3 0.94
4 0.95
5 0.94
6 0.93
7 0.86
8 0.83
9 0.76
10 0.72
11 0.68
12 0.63
13 0.54
14 0.46
15 0.41
16 0.34
17 0.31
18 0.31
19 0.28
20 0.23
21 0.23
22 0.27
23 0.28
24 0.31
25 0.32
26 0.3
27 0.33
28 0.36
29 0.43
30 0.46
31 0.56
32 0.62
33 0.7
34 0.75
35 0.74
36 0.8
37 0.78
38 0.78
39 0.76
40 0.68
41 0.64
42 0.61
43 0.58
44 0.52
45 0.46
46 0.39
47 0.31
48 0.29
49 0.23
50 0.19
51 0.16
52 0.12
53 0.11
54 0.12
55 0.12
56 0.12
57 0.12
58 0.1
59 0.1
60 0.1
61 0.1
62 0.08
63 0.08
64 0.09
65 0.08
66 0.07
67 0.09
68 0.08
69 0.1
70 0.11
71 0.11
72 0.1
73 0.11
74 0.14
75 0.15
76 0.16
77 0.2
78 0.22
79 0.22
80 0.24
81 0.25
82 0.29
83 0.29
84 0.31
85 0.32
86 0.34
87 0.34
88 0.33
89 0.32
90 0.24
91 0.27
92 0.25
93 0.21
94 0.2
95 0.21
96 0.22
97 0.27