Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3EZ01

Protein Details
Accession A0A0C3EZ01    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
8-27IVLVKCTSRRTRCERRPVVEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, cyto 3
Family & Domain DBs
Amino Acid Sequences MYPAAQSIVLVKCTSRRTRCERRPVVEDSTIVSAPRFQIALPFMGNLPDVPFQIHDFVFWWEENVVSYGYITAFSRMGDDTVIARVKRYGYYARQPGAIVLLPTAALNNLVP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.4
3 0.46
4 0.54
5 0.65
6 0.74
7 0.8
8 0.81
9 0.78
10 0.77
11 0.74
12 0.7
13 0.62
14 0.52
15 0.43
16 0.37
17 0.31
18 0.25
19 0.2
20 0.15
21 0.12
22 0.13
23 0.11
24 0.07
25 0.1
26 0.11
27 0.12
28 0.11
29 0.11
30 0.1
31 0.11
32 0.11
33 0.08
34 0.08
35 0.08
36 0.08
37 0.08
38 0.08
39 0.09
40 0.1
41 0.1
42 0.08
43 0.08
44 0.09
45 0.1
46 0.09
47 0.09
48 0.08
49 0.08
50 0.08
51 0.08
52 0.07
53 0.05
54 0.05
55 0.05
56 0.05
57 0.06
58 0.06
59 0.06
60 0.06
61 0.06
62 0.08
63 0.08
64 0.08
65 0.07
66 0.08
67 0.07
68 0.11
69 0.15
70 0.13
71 0.14
72 0.15
73 0.17
74 0.17
75 0.21
76 0.24
77 0.27
78 0.37
79 0.43
80 0.43
81 0.43
82 0.42
83 0.39
84 0.35
85 0.3
86 0.21
87 0.14
88 0.12
89 0.11
90 0.1
91 0.1
92 0.07