Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3C4Y7

Protein Details
Accession A0A0C3C4Y7    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
248-275EPLLKVPKIKVKGRKKRSPPTNGEKGLMHydrophilic
NLS Segment(s)
PositionSequence
253-281VPKIKVKGRKKRSPPTNGEKGLMPKGRLA
Subcellular Location(s) mito_nucl 9.666, nucl 9.5, mito 9.5, cyto_nucl 8.833, cyto_mito 8.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR016159  Cullin_repeat-like_dom_sf  
Amino Acid Sequences MMSKDKGKQVAIPTPLSSPSTGSTSPASSLSALWSYLFPALDHIVRSQVTAEFEKISAPSIAVDYHMGVHTNVYNYFTAQSESANGTKKDRSAQISGKDLYEQLDKYYADTARELLLGAPDDDATLIHYLVPCFNRYNAGASSVNRLLNYVNRHYVKRAVDEDKGWLRLNDVFDAVAKTITDSDTREKISKRLRERKTEELKMWGYEDGGSAELLAEAEACAEAASSLDRIVPLSSLALRRFRIECVEPLLKVPKIKVKGRKKRSPPTNGEKGLMPKGRLARAIKELLETQGGDEDEKCRLAVETATMLKTVGVRADQPLRKKLDKFVIAATV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.41
3 0.37
4 0.3
5 0.24
6 0.22
7 0.24
8 0.22
9 0.22
10 0.22
11 0.22
12 0.22
13 0.21
14 0.2
15 0.16
16 0.16
17 0.16
18 0.15
19 0.14
20 0.13
21 0.12
22 0.12
23 0.14
24 0.14
25 0.11
26 0.13
27 0.15
28 0.16
29 0.17
30 0.16
31 0.17
32 0.17
33 0.18
34 0.16
35 0.16
36 0.18
37 0.19
38 0.2
39 0.18
40 0.18
41 0.19
42 0.17
43 0.17
44 0.13
45 0.11
46 0.1
47 0.1
48 0.1
49 0.1
50 0.1
51 0.09
52 0.1
53 0.1
54 0.1
55 0.09
56 0.11
57 0.11
58 0.12
59 0.13
60 0.14
61 0.13
62 0.13
63 0.14
64 0.14
65 0.13
66 0.12
67 0.12
68 0.11
69 0.14
70 0.16
71 0.21
72 0.21
73 0.23
74 0.25
75 0.27
76 0.3
77 0.32
78 0.33
79 0.35
80 0.4
81 0.41
82 0.45
83 0.44
84 0.4
85 0.35
86 0.31
87 0.26
88 0.24
89 0.19
90 0.14
91 0.17
92 0.16
93 0.16
94 0.2
95 0.19
96 0.17
97 0.17
98 0.17
99 0.14
100 0.14
101 0.13
102 0.09
103 0.09
104 0.08
105 0.08
106 0.07
107 0.06
108 0.06
109 0.06
110 0.05
111 0.06
112 0.06
113 0.05
114 0.06
115 0.06
116 0.07
117 0.1
118 0.11
119 0.11
120 0.12
121 0.12
122 0.14
123 0.14
124 0.17
125 0.15
126 0.18
127 0.19
128 0.18
129 0.23
130 0.23
131 0.23
132 0.19
133 0.19
134 0.16
135 0.18
136 0.21
137 0.19
138 0.23
139 0.25
140 0.26
141 0.27
142 0.32
143 0.29
144 0.29
145 0.31
146 0.28
147 0.28
148 0.27
149 0.3
150 0.27
151 0.28
152 0.24
153 0.19
154 0.17
155 0.18
156 0.19
157 0.15
158 0.12
159 0.1
160 0.1
161 0.11
162 0.1
163 0.07
164 0.06
165 0.05
166 0.06
167 0.06
168 0.07
169 0.08
170 0.12
171 0.14
172 0.16
173 0.2
174 0.2
175 0.26
176 0.34
177 0.4
178 0.47
179 0.55
180 0.59
181 0.66
182 0.71
183 0.75
184 0.76
185 0.73
186 0.64
187 0.61
188 0.56
189 0.47
190 0.42
191 0.31
192 0.22
193 0.17
194 0.15
195 0.09
196 0.08
197 0.07
198 0.06
199 0.05
200 0.05
201 0.05
202 0.04
203 0.03
204 0.03
205 0.03
206 0.03
207 0.03
208 0.03
209 0.03
210 0.03
211 0.03
212 0.04
213 0.04
214 0.04
215 0.04
216 0.05
217 0.05
218 0.06
219 0.06
220 0.06
221 0.07
222 0.09
223 0.13
224 0.16
225 0.2
226 0.21
227 0.24
228 0.25
229 0.25
230 0.28
231 0.27
232 0.26
233 0.29
234 0.31
235 0.27
236 0.29
237 0.33
238 0.3
239 0.29
240 0.3
241 0.3
242 0.34
243 0.42
244 0.5
245 0.56
246 0.65
247 0.74
248 0.81
249 0.84
250 0.88
251 0.9
252 0.91
253 0.89
254 0.88
255 0.88
256 0.8
257 0.72
258 0.65
259 0.59
260 0.57
261 0.51
262 0.43
263 0.38
264 0.4
265 0.41
266 0.44
267 0.42
268 0.39
269 0.41
270 0.44
271 0.39
272 0.37
273 0.35
274 0.3
275 0.29
276 0.24
277 0.18
278 0.18
279 0.18
280 0.16
281 0.16
282 0.16
283 0.16
284 0.16
285 0.15
286 0.12
287 0.12
288 0.13
289 0.13
290 0.14
291 0.17
292 0.2
293 0.2
294 0.2
295 0.19
296 0.19
297 0.19
298 0.17
299 0.14
300 0.13
301 0.14
302 0.2
303 0.29
304 0.34
305 0.4
306 0.47
307 0.51
308 0.57
309 0.58
310 0.61
311 0.62
312 0.62
313 0.58