Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3G1A9

Protein Details
Accession A0A0C3G1A9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
11-30SAEHERKQHKLKRLVQSPNSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18.5, cyto_mito 11.333, cyto_nucl 3.333, cyto 3, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000592  Ribosomal_S27  
IPR023407  Ribosomal_S27_Zn-bd_dom_sf  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0046872  F:metal ion binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01667  Ribosomal_S27e  
PROSITE View protein in PROSITE  
PS01168  RIBOSOMAL_S27E  
Amino Acid Sequences MTLAVDLLNPSAEHERKQHKLKRLVQSPNSFFMDVKCPGCFAITTVFSHAQTVVLCGSCASVLCQPTGGKARLTEGCSFRRKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.36
3 0.43
4 0.53
5 0.57
6 0.6
7 0.68
8 0.75
9 0.78
10 0.78
11 0.8
12 0.78
13 0.8
14 0.73
15 0.68
16 0.61
17 0.51
18 0.42
19 0.34
20 0.31
21 0.25
22 0.23
23 0.18
24 0.16
25 0.15
26 0.16
27 0.14
28 0.09
29 0.1
30 0.1
31 0.11
32 0.13
33 0.14
34 0.14
35 0.14
36 0.13
37 0.11
38 0.1
39 0.1
40 0.08
41 0.07
42 0.07
43 0.07
44 0.07
45 0.06
46 0.06
47 0.07
48 0.1
49 0.11
50 0.11
51 0.13
52 0.13
53 0.18
54 0.24
55 0.23
56 0.21
57 0.22
58 0.27
59 0.3
60 0.33
61 0.35
62 0.35
63 0.41