Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3G5A4

Protein Details
Accession A0A0C3G5A4    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
5-25ESEHKCWKDGCNKKKTNCTAHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, nucl 3.5, cyto_nucl 3.5, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MPGSESEHKCWKDGCNKKKTNCTAHYWKCYGTGTRTHGEQKVMKGGKCESNSRDTVSGELAKCGLKEGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.6
3 0.68
4 0.73
5 0.8
6 0.81
7 0.8
8 0.74
9 0.73
10 0.73
11 0.72
12 0.72
13 0.63
14 0.56
15 0.48
16 0.45
17 0.39
18 0.31
19 0.29
20 0.26
21 0.26
22 0.27
23 0.28
24 0.28
25 0.29
26 0.29
27 0.25
28 0.3
29 0.32
30 0.31
31 0.3
32 0.31
33 0.35
34 0.35
35 0.39
36 0.33
37 0.36
38 0.38
39 0.38
40 0.37
41 0.31
42 0.29
43 0.28
44 0.3
45 0.24
46 0.23
47 0.22
48 0.2
49 0.19