Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3BPN5

Protein Details
Accession A0A0C3BPN5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
86-105FPPFRRFDRVKAKKRFVWISHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 14, cyto 4.5, cyto_nucl 4, mito 3, E.R. 3
Family & Domain DBs
Amino Acid Sequences MSGNCWSESYMTIPLAVYLITCRVSISDIRFWHCFIKKATPLSPLILTTHYYFWHSCVALMETIYVDSGEPSYSSTIDVSLHLVAFPPFRRFDRVKAKKRFVWISSNEISRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.11
4 0.08
5 0.06
6 0.08
7 0.09
8 0.09
9 0.09
10 0.09
11 0.11
12 0.14
13 0.17
14 0.22
15 0.23
16 0.27
17 0.28
18 0.29
19 0.34
20 0.33
21 0.33
22 0.3
23 0.37
24 0.37
25 0.41
26 0.42
27 0.38
28 0.37
29 0.35
30 0.33
31 0.25
32 0.21
33 0.18
34 0.17
35 0.15
36 0.14
37 0.12
38 0.14
39 0.13
40 0.13
41 0.14
42 0.13
43 0.11
44 0.11
45 0.12
46 0.1
47 0.1
48 0.09
49 0.06
50 0.06
51 0.06
52 0.05
53 0.04
54 0.04
55 0.04
56 0.04
57 0.04
58 0.05
59 0.06
60 0.06
61 0.07
62 0.07
63 0.07
64 0.08
65 0.08
66 0.09
67 0.08
68 0.08
69 0.07
70 0.08
71 0.08
72 0.11
73 0.13
74 0.15
75 0.18
76 0.2
77 0.27
78 0.3
79 0.38
80 0.47
81 0.56
82 0.62
83 0.7
84 0.76
85 0.74
86 0.8
87 0.79
88 0.72
89 0.71
90 0.65
91 0.62
92 0.6