Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3F3Z5

Protein Details
Accession A0A0C3F3Z5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
6-28QSIVLVKRTLRRARRERRSVVENHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, cyto 2, plas 2, pero 2, cyto_pero 2
Family & Domain DBs
Amino Acid Sequences MYPAAQSIVLVKRTLRRARRERRSVVENSTNVRVLPFQLALPFMGNLPGVPFQIHDFVFWWEWNVISYGYVTAFSCMGDGTVIASVATVMTDVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.48
3 0.54
4 0.63
5 0.73
6 0.82
7 0.85
8 0.83
9 0.81
10 0.8
11 0.74
12 0.7
13 0.67
14 0.59
15 0.53
16 0.48
17 0.41
18 0.34
19 0.29
20 0.22
21 0.15
22 0.14
23 0.11
24 0.09
25 0.09
26 0.1
27 0.09
28 0.09
29 0.08
30 0.06
31 0.06
32 0.06
33 0.05
34 0.06
35 0.06
36 0.06
37 0.06
38 0.06
39 0.07
40 0.1
41 0.1
42 0.09
43 0.09
44 0.11
45 0.12
46 0.12
47 0.13
48 0.1
49 0.1
50 0.1
51 0.1
52 0.08
53 0.08
54 0.08
55 0.07
56 0.07
57 0.08
58 0.08
59 0.07
60 0.07
61 0.07
62 0.07
63 0.06
64 0.06
65 0.05
66 0.05
67 0.05
68 0.05
69 0.06
70 0.05
71 0.05
72 0.05
73 0.05
74 0.05