Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3ESH1

Protein Details
Accession A0A0C3ESH1    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
55-82DHNGERKSRDKKRSGKSSKKWKMVNDKDBasic
NLS Segment(s)
PositionSequence
59-76ERKSRDKKRSGKSSKKWK
Subcellular Location(s) cyto 17.5, cyto_nucl 12, nucl 5.5, mito 2, plas 2
Family & Domain DBs
Amino Acid Sequences MVCVSSTMAPDESTSLVQRCTDFVSEHKKAIIGTAAVAIAVGGAAYYASSPGAGDHNGERKSRDKKRSGKSSKKWKMVNDKDGPIIEERSPKVVEEQGKQKLFLPTCNWI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.16
4 0.17
5 0.17
6 0.16
7 0.18
8 0.18
9 0.16
10 0.2
11 0.29
12 0.29
13 0.3
14 0.29
15 0.27
16 0.25
17 0.25
18 0.22
19 0.12
20 0.1
21 0.1
22 0.09
23 0.08
24 0.08
25 0.06
26 0.04
27 0.03
28 0.02
29 0.01
30 0.01
31 0.01
32 0.02
33 0.02
34 0.02
35 0.02
36 0.02
37 0.03
38 0.03
39 0.05
40 0.05
41 0.06
42 0.08
43 0.14
44 0.16
45 0.17
46 0.19
47 0.24
48 0.34
49 0.42
50 0.49
51 0.53
52 0.6
53 0.7
54 0.79
55 0.83
56 0.84
57 0.85
58 0.88
59 0.88
60 0.87
61 0.82
62 0.79
63 0.8
64 0.78
65 0.79
66 0.74
67 0.66
68 0.61
69 0.57
70 0.5
71 0.41
72 0.34
73 0.27
74 0.26
75 0.25
76 0.25
77 0.26
78 0.24
79 0.25
80 0.28
81 0.31
82 0.32
83 0.39
84 0.45
85 0.46
86 0.46
87 0.47
88 0.5
89 0.47
90 0.46