Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3BFY0

Protein Details
Accession A0A0C3BFY0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
60-79RKGRVYNICSKNPKHKQRQGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
Amino Acid Sequences MFRSILASSRPLLARCRLASLAHVRTHPHNLAATTSTITRGMKVRASVRPMCDGCTIVVRKGRVYNICSKNPKHKQRQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.31
3 0.35
4 0.31
5 0.29
6 0.32
7 0.36
8 0.37
9 0.33
10 0.33
11 0.31
12 0.33
13 0.38
14 0.34
15 0.28
16 0.23
17 0.21
18 0.21
19 0.2
20 0.18
21 0.13
22 0.12
23 0.11
24 0.11
25 0.11
26 0.11
27 0.11
28 0.12
29 0.13
30 0.16
31 0.2
32 0.22
33 0.28
34 0.3
35 0.3
36 0.35
37 0.34
38 0.34
39 0.31
40 0.28
41 0.22
42 0.27
43 0.26
44 0.22
45 0.26
46 0.24
47 0.26
48 0.29
49 0.34
50 0.33
51 0.36
52 0.43
53 0.47
54 0.55
55 0.61
56 0.63
57 0.68
58 0.73
59 0.79