Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3G3A3

Protein Details
Accession A0A0C3G3A3    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
44-63PEPTKRSKTAKKAWEQNLAKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 9, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR035521  Fus1_SH3  
IPR036028  SH3-like_dom_sf  
IPR001452  SH3_domain  
Pfam View protein in Pfam  
PF14604  SH3_9  
PROSITE View protein in PROSITE  
PS50002  SH3  
CDD cd11854  SH3_Fus1p  
Amino Acid Sequences MRVDFKSATFDMGEPHKAVLKPIPPPPSAGVGWVPQLRADITLPEPTKRSKTAKKAWEQNLAKFMAPTVPEREPPPYYMARAAPAMPTMPPMPVKLPQQTLPPTPAATLKLSFDGIIPPPSQKPKPSRTSSYGPHPALAPRLSLSSRKSDRKFPRLMTVAHPFEPSMDDELSIGLGETVRLLEEYEDEWCLVQRVGRIDAMKGVVPRFCLMERAEVIPSHPRHPSAGSYRC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.26
4 0.24
5 0.27
6 0.29
7 0.3
8 0.33
9 0.39
10 0.44
11 0.4
12 0.43
13 0.43
14 0.41
15 0.36
16 0.32
17 0.28
18 0.23
19 0.27
20 0.25
21 0.23
22 0.18
23 0.19
24 0.17
25 0.17
26 0.16
27 0.14
28 0.14
29 0.22
30 0.22
31 0.24
32 0.26
33 0.28
34 0.32
35 0.35
36 0.42
37 0.44
38 0.53
39 0.6
40 0.67
41 0.73
42 0.78
43 0.78
44 0.81
45 0.75
46 0.69
47 0.65
48 0.57
49 0.48
50 0.37
51 0.31
52 0.23
53 0.21
54 0.19
55 0.19
56 0.19
57 0.2
58 0.22
59 0.27
60 0.25
61 0.25
62 0.27
63 0.24
64 0.24
65 0.25
66 0.24
67 0.21
68 0.2
69 0.19
70 0.15
71 0.14
72 0.12
73 0.09
74 0.1
75 0.09
76 0.1
77 0.1
78 0.11
79 0.12
80 0.15
81 0.19
82 0.2
83 0.22
84 0.23
85 0.27
86 0.29
87 0.29
88 0.28
89 0.25
90 0.22
91 0.2
92 0.2
93 0.16
94 0.15
95 0.14
96 0.12
97 0.12
98 0.12
99 0.11
100 0.1
101 0.09
102 0.09
103 0.1
104 0.1
105 0.1
106 0.12
107 0.17
108 0.19
109 0.23
110 0.3
111 0.36
112 0.44
113 0.49
114 0.52
115 0.53
116 0.57
117 0.55
118 0.57
119 0.57
120 0.49
121 0.44
122 0.38
123 0.34
124 0.32
125 0.28
126 0.2
127 0.12
128 0.14
129 0.15
130 0.17
131 0.18
132 0.24
133 0.3
134 0.38
135 0.41
136 0.49
137 0.57
138 0.62
139 0.66
140 0.59
141 0.61
142 0.57
143 0.56
144 0.52
145 0.51
146 0.45
147 0.4
148 0.38
149 0.29
150 0.26
151 0.25
152 0.21
153 0.15
154 0.12
155 0.11
156 0.11
157 0.11
158 0.1
159 0.09
160 0.07
161 0.04
162 0.04
163 0.04
164 0.04
165 0.04
166 0.04
167 0.04
168 0.05
169 0.05
170 0.06
171 0.07
172 0.08
173 0.09
174 0.09
175 0.09
176 0.09
177 0.1
178 0.09
179 0.1
180 0.12
181 0.15
182 0.17
183 0.2
184 0.21
185 0.2
186 0.23
187 0.23
188 0.22
189 0.22
190 0.21
191 0.19
192 0.2
193 0.21
194 0.21
195 0.2
196 0.21
197 0.2
198 0.25
199 0.25
200 0.26
201 0.27
202 0.25
203 0.27
204 0.32
205 0.33
206 0.31
207 0.32
208 0.31
209 0.32
210 0.35
211 0.4