Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q6BYR4

Protein Details
Accession Q6BYR4    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
204-234VNNWRSYTNKIEKPKSKSKKKSGNSKKNVLAHydrophilic
NLS Segment(s)
PositionSequence
214-230IEKPKSKSKKKSGNSKK
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001623  DnaJ_domain  
IPR036869  J_dom_sf  
KEGG dha:DEHA2A07546g  -  
Pfam View protein in Pfam  
PF00226  DnaJ  
PROSITE View protein in PROSITE  
PS50076  DNAJ_2  
CDD cd06257  DnaJ  
Amino Acid Sequences MSDDLDRVLSTEESALVKDREIERVLNCCPWDYYSILEINPLKKDIQLQNQIKRTYRKKTLLIHPDKVSNPNAPHAFDRLKKAELVLSFDIPESESEIESQDDTSKLYVNEKKRLLAIYNDAENRLLRSKKIIQGDTYSEENYKQILQIVTEILNEEIKQEEIERNFQQQQEAKKMAELKKVQQERELKKKLANKWEDERDIRVNNWRSYTNKIEKPKSKSKKKSGNSKKNVLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.16
3 0.14
4 0.14
5 0.19
6 0.2
7 0.23
8 0.24
9 0.27
10 0.26
11 0.31
12 0.33
13 0.32
14 0.31
15 0.27
16 0.27
17 0.25
18 0.25
19 0.21
20 0.21
21 0.19
22 0.21
23 0.19
24 0.23
25 0.24
26 0.24
27 0.25
28 0.25
29 0.22
30 0.21
31 0.29
32 0.3
33 0.37
34 0.44
35 0.5
36 0.57
37 0.64
38 0.67
39 0.65
40 0.67
41 0.66
42 0.65
43 0.67
44 0.65
45 0.65
46 0.7
47 0.74
48 0.76
49 0.76
50 0.73
51 0.66
52 0.64
53 0.59
54 0.54
55 0.47
56 0.41
57 0.35
58 0.35
59 0.35
60 0.31
61 0.31
62 0.31
63 0.33
64 0.3
65 0.35
66 0.31
67 0.31
68 0.29
69 0.28
70 0.27
71 0.23
72 0.25
73 0.2
74 0.18
75 0.17
76 0.17
77 0.16
78 0.13
79 0.12
80 0.09
81 0.08
82 0.07
83 0.07
84 0.08
85 0.09
86 0.08
87 0.09
88 0.07
89 0.07
90 0.07
91 0.07
92 0.08
93 0.08
94 0.14
95 0.19
96 0.23
97 0.3
98 0.31
99 0.31
100 0.31
101 0.32
102 0.27
103 0.23
104 0.23
105 0.18
106 0.2
107 0.2
108 0.19
109 0.18
110 0.17
111 0.17
112 0.17
113 0.16
114 0.13
115 0.18
116 0.22
117 0.27
118 0.33
119 0.32
120 0.29
121 0.32
122 0.34
123 0.32
124 0.29
125 0.25
126 0.19
127 0.18
128 0.17
129 0.15
130 0.12
131 0.09
132 0.1
133 0.09
134 0.09
135 0.1
136 0.1
137 0.1
138 0.1
139 0.1
140 0.08
141 0.08
142 0.08
143 0.07
144 0.07
145 0.07
146 0.07
147 0.08
148 0.12
149 0.13
150 0.19
151 0.2
152 0.25
153 0.27
154 0.28
155 0.32
156 0.32
157 0.36
158 0.38
159 0.39
160 0.34
161 0.35
162 0.42
163 0.41
164 0.45
165 0.43
166 0.42
167 0.49
168 0.55
169 0.53
170 0.53
171 0.58
172 0.58
173 0.65
174 0.66
175 0.58
176 0.59
177 0.65
178 0.66
179 0.67
180 0.65
181 0.61
182 0.63
183 0.7
184 0.7
185 0.65
186 0.62
187 0.58
188 0.54
189 0.5
190 0.51
191 0.49
192 0.46
193 0.47
194 0.46
195 0.42
196 0.47
197 0.54
198 0.54
199 0.55
200 0.61
201 0.68
202 0.72
203 0.77
204 0.82
205 0.83
206 0.84
207 0.87
208 0.88
209 0.89
210 0.9
211 0.93
212 0.93
213 0.93
214 0.91