Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9DDT7

Protein Details
Accession E9DDT7   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
89-108MIRSNRKKAAKAKAAAKKKAHydrophilic
NLS Segment(s)
PositionSequence
93-108NRKKAAKAKAAAKKKA
Subcellular Location(s) plas 17, mito 4, E.R. 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009914  DPM2  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0030234  F:enzyme regulator activity  
GO:0019348  P:dolichol metabolic process  
GO:0006486  P:protein glycosylation  
Pfam View protein in Pfam  
PF07297  DPM2  
Amino Acid Sequences MVSLPLEDDETRATNANRAQFGQLFGLAMLLAATAIFLYYTAWTLLMPFVDPGHPLHDLFPPRVWAIRIPVILTLLGSAVVGTFLGLVMIRSNRKKAAKAKAAAKKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.25
3 0.29
4 0.28
5 0.27
6 0.29
7 0.27
8 0.29
9 0.25
10 0.21
11 0.16
12 0.14
13 0.12
14 0.08
15 0.07
16 0.05
17 0.03
18 0.03
19 0.02
20 0.02
21 0.02
22 0.02
23 0.02
24 0.02
25 0.03
26 0.03
27 0.04
28 0.04
29 0.05
30 0.05
31 0.05
32 0.05
33 0.05
34 0.05
35 0.05
36 0.05
37 0.05
38 0.06
39 0.06
40 0.08
41 0.09
42 0.09
43 0.1
44 0.14
45 0.15
46 0.16
47 0.16
48 0.15
49 0.15
50 0.16
51 0.16
52 0.13
53 0.15
54 0.18
55 0.18
56 0.17
57 0.17
58 0.16
59 0.15
60 0.14
61 0.1
62 0.06
63 0.05
64 0.04
65 0.04
66 0.03
67 0.03
68 0.03
69 0.03
70 0.03
71 0.02
72 0.03
73 0.03
74 0.03
75 0.06
76 0.1
77 0.17
78 0.21
79 0.25
80 0.32
81 0.37
82 0.45
83 0.52
84 0.59
85 0.62
86 0.66
87 0.73
88 0.75