Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3EW02

Protein Details
Accession A0A0C3EW02    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
56-81LPNRQTSKWRSSKPRRKPKSNSSCSWHydrophilic
NLS Segment(s)
PositionSequence
64-74WRSSKPRRKPK
Subcellular Location(s) nucl 15, cyto_nucl 10.833, mito_nucl 10.333, cyto 5.5, mito 4.5
Family & Domain DBs
Amino Acid Sequences MVQIKATTTRHNIMQSDGRQDLFCRREHCSNGFVYKLSCNDISPRSTPHRPVSLILPNRQTSKWRSSKPRRKPKSNSSCSWILILSYVTHVNVQLITSKVCRCPYLSLSELMHVSIFKKGMWRWRVRVQAKCGIMFSRGRIVGAGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.41
3 0.42
4 0.41
5 0.37
6 0.33
7 0.34
8 0.37
9 0.32
10 0.33
11 0.3
12 0.34
13 0.39
14 0.44
15 0.45
16 0.4
17 0.4
18 0.39
19 0.37
20 0.33
21 0.27
22 0.25
23 0.24
24 0.24
25 0.2
26 0.18
27 0.21
28 0.23
29 0.25
30 0.23
31 0.27
32 0.31
33 0.35
34 0.39
35 0.4
36 0.42
37 0.4
38 0.39
39 0.4
40 0.41
41 0.41
42 0.4
43 0.4
44 0.37
45 0.38
46 0.38
47 0.36
48 0.32
49 0.37
50 0.41
51 0.44
52 0.53
53 0.62
54 0.71
55 0.79
56 0.85
57 0.85
58 0.87
59 0.88
60 0.88
61 0.88
62 0.85
63 0.77
64 0.71
65 0.64
66 0.55
67 0.47
68 0.35
69 0.24
70 0.17
71 0.15
72 0.09
73 0.08
74 0.08
75 0.07
76 0.07
77 0.07
78 0.07
79 0.07
80 0.07
81 0.08
82 0.08
83 0.09
84 0.12
85 0.14
86 0.17
87 0.19
88 0.2
89 0.19
90 0.23
91 0.25
92 0.28
93 0.28
94 0.27
95 0.27
96 0.27
97 0.26
98 0.21
99 0.19
100 0.13
101 0.12
102 0.12
103 0.12
104 0.1
105 0.16
106 0.18
107 0.27
108 0.36
109 0.43
110 0.47
111 0.55
112 0.65
113 0.68
114 0.73
115 0.71
116 0.7
117 0.66
118 0.62
119 0.55
120 0.46
121 0.43
122 0.37
123 0.33
124 0.33
125 0.29
126 0.28