Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3CAK6

Protein Details
Accession A0A0C3CAK6    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
151-180FRPSRSASPSPPRVKHRRRRHQLEYIVHGLHydrophilic
NLS Segment(s)
PositionSequence
158-170SPSPPRVKHRRRR
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MSFSLVNSDAPKAFPVHAHDADNIRPVIQNTGLGPIPHLELPMSNMPTGYSSHPFASSLREHLDPSVQSPNSGLPLAAPDSLAEANCLLGVAHAARDVCRTAKRLADYQVKETLLRAELYRFQAAKAEQQLRVAEMDVGRARLVLREGGFFRPSRSASPSPPRVKHRRRRHQLEYIVHGLKARLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.24
3 0.29
4 0.31
5 0.32
6 0.34
7 0.35
8 0.36
9 0.37
10 0.31
11 0.23
12 0.23
13 0.21
14 0.22
15 0.19
16 0.19
17 0.15
18 0.19
19 0.19
20 0.17
21 0.17
22 0.14
23 0.15
24 0.14
25 0.13
26 0.1
27 0.09
28 0.13
29 0.17
30 0.18
31 0.16
32 0.16
33 0.16
34 0.16
35 0.18
36 0.17
37 0.15
38 0.16
39 0.17
40 0.17
41 0.18
42 0.17
43 0.2
44 0.18
45 0.18
46 0.19
47 0.19
48 0.19
49 0.19
50 0.21
51 0.17
52 0.18
53 0.23
54 0.2
55 0.19
56 0.19
57 0.19
58 0.18
59 0.17
60 0.14
61 0.07
62 0.08
63 0.09
64 0.09
65 0.08
66 0.06
67 0.08
68 0.08
69 0.08
70 0.07
71 0.05
72 0.05
73 0.05
74 0.05
75 0.03
76 0.03
77 0.03
78 0.03
79 0.03
80 0.04
81 0.04
82 0.05
83 0.06
84 0.07
85 0.09
86 0.11
87 0.14
88 0.15
89 0.18
90 0.2
91 0.22
92 0.28
93 0.35
94 0.35
95 0.35
96 0.38
97 0.35
98 0.33
99 0.3
100 0.25
101 0.17
102 0.16
103 0.14
104 0.11
105 0.15
106 0.18
107 0.21
108 0.2
109 0.18
110 0.22
111 0.22
112 0.25
113 0.29
114 0.29
115 0.27
116 0.29
117 0.3
118 0.27
119 0.26
120 0.22
121 0.16
122 0.12
123 0.16
124 0.14
125 0.14
126 0.13
127 0.13
128 0.12
129 0.12
130 0.13
131 0.12
132 0.12
133 0.15
134 0.17
135 0.21
136 0.23
137 0.22
138 0.24
139 0.26
140 0.27
141 0.26
142 0.32
143 0.33
144 0.39
145 0.48
146 0.56
147 0.6
148 0.66
149 0.72
150 0.76
151 0.83
152 0.85
153 0.86
154 0.88
155 0.9
156 0.92
157 0.92
158 0.91
159 0.9
160 0.87
161 0.83
162 0.8
163 0.71
164 0.61
165 0.53