Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3B1D1

Protein Details
Accession A0A0C3B1D1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
7-29SIVLVRRTSCRTRRERRPIVEDSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22.5, cyto_mito 13, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MYPAAQSIVLVRRTSCRTRRERRPIVEDSTNARRFRFQIALPFMGNLPGVPFQIHNFVFWWEESVVSYGYITAFSRMSDFVDPSFA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.44
3 0.48
4 0.56
5 0.65
6 0.75
7 0.8
8 0.84
9 0.83
10 0.83
11 0.78
12 0.75
13 0.69
14 0.6
15 0.55
16 0.55
17 0.53
18 0.46
19 0.41
20 0.37
21 0.33
22 0.35
23 0.33
24 0.24
25 0.26
26 0.29
27 0.31
28 0.28
29 0.27
30 0.23
31 0.2
32 0.18
33 0.1
34 0.07
35 0.06
36 0.06
37 0.06
38 0.07
39 0.07
40 0.13
41 0.13
42 0.13
43 0.13
44 0.14
45 0.15
46 0.14
47 0.16
48 0.11
49 0.11
50 0.11
51 0.11
52 0.11
53 0.1
54 0.1
55 0.07
56 0.07
57 0.08
58 0.08
59 0.09
60 0.08
61 0.09
62 0.11
63 0.11
64 0.14
65 0.15
66 0.16