Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3BNC8

Protein Details
Accession A0A0C3BNC8    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
56-75AKARYDYEARRRWKKDRPKMBasic
NLS Segment(s)
PositionSequence
64-75ARRRWKKDRPKM
Subcellular Location(s) nucl 17, mito 8.5, cyto_mito 5
Family & Domain DBs
Amino Acid Sequences MTAALQMPSPKKTKKGGSPLPVLPDLNPTLSPADAIAEAWKKESQENQEKWRREDAKARYDYEARRRWKKDRPKM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.63
3 0.67
4 0.67
5 0.7
6 0.67
7 0.64
8 0.57
9 0.48
10 0.38
11 0.32
12 0.26
13 0.21
14 0.18
15 0.15
16 0.13
17 0.12
18 0.12
19 0.08
20 0.08
21 0.06
22 0.06
23 0.07
24 0.08
25 0.08
26 0.1
27 0.11
28 0.11
29 0.13
30 0.17
31 0.23
32 0.32
33 0.37
34 0.45
35 0.52
36 0.55
37 0.57
38 0.62
39 0.57
40 0.52
41 0.56
42 0.54
43 0.56
44 0.58
45 0.57
46 0.52
47 0.54
48 0.58
49 0.59
50 0.59
51 0.58
52 0.64
53 0.68
54 0.73
55 0.78