Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E9D1N4

Protein Details
Accession E9D1N4    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
50-74IRKCVQAKPRRHGRRYERSRDNSATHydrophilic
NLS Segment(s)
PositionSequence
59-63RRHGR
Subcellular Location(s) nucl 19.5, mito_nucl 12.666, cyto_nucl 11.833, mito 4.5
Family & Domain DBs
Amino Acid Sequences MTTNPFPPNPPGNTKHTPPPLLNSEPRLCPDARTPYRGKTSWMNYPLQMIRKCVQAKPRRHGRRYERSRDNSATGSRKPPITVTHT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.56
3 0.56
4 0.55
5 0.49
6 0.51
7 0.49
8 0.49
9 0.49
10 0.46
11 0.43
12 0.4
13 0.4
14 0.37
15 0.31
16 0.27
17 0.29
18 0.34
19 0.33
20 0.37
21 0.38
22 0.4
23 0.46
24 0.44
25 0.41
26 0.37
27 0.38
28 0.39
29 0.4
30 0.36
31 0.3
32 0.33
33 0.33
34 0.33
35 0.31
36 0.27
37 0.25
38 0.31
39 0.33
40 0.33
41 0.4
42 0.42
43 0.5
44 0.56
45 0.66
46 0.69
47 0.71
48 0.78
49 0.79
50 0.81
51 0.83
52 0.84
53 0.83
54 0.8
55 0.83
56 0.77
57 0.71
58 0.64
59 0.62
60 0.58
61 0.52
62 0.51
63 0.47
64 0.45
65 0.42
66 0.41