Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3AVU2

Protein Details
Accession A0A0C3AVU2    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
44-63TTCKPKSKILQGKKFREQKYHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 6, cyto_nucl 5.5, extr 5, mito 4, E.R. 4, nucl 3, plas 2, pero 2
Family & Domain DBs
Amino Acid Sequences MEASQACLLLLFVLVALWYFIALHESKIESKGTPYAFCMPSLSTTCKPKSKILQGKKFREQKYISVNEFENLRVDLKASVPRGRQYVLSGTIQNQSKTVQNLSKPSPKPYLIRVVSF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.03
3 0.03
4 0.03
5 0.03
6 0.03
7 0.03
8 0.06
9 0.07
10 0.08
11 0.09
12 0.11
13 0.12
14 0.14
15 0.16
16 0.13
17 0.15
18 0.19
19 0.19
20 0.18
21 0.2
22 0.24
23 0.24
24 0.24
25 0.23
26 0.18
27 0.2
28 0.22
29 0.25
30 0.22
31 0.27
32 0.32
33 0.35
34 0.38
35 0.4
36 0.44
37 0.5
38 0.56
39 0.6
40 0.66
41 0.71
42 0.76
43 0.79
44 0.8
45 0.72
46 0.69
47 0.61
48 0.57
49 0.56
50 0.54
51 0.47
52 0.4
53 0.39
54 0.32
55 0.3
56 0.25
57 0.17
58 0.12
59 0.12
60 0.09
61 0.09
62 0.09
63 0.1
64 0.15
65 0.17
66 0.21
67 0.23
68 0.26
69 0.27
70 0.28
71 0.27
72 0.24
73 0.26
74 0.24
75 0.24
76 0.23
77 0.22
78 0.28
79 0.3
80 0.27
81 0.24
82 0.22
83 0.24
84 0.26
85 0.29
86 0.29
87 0.31
88 0.37
89 0.43
90 0.51
91 0.5
92 0.53
93 0.54
94 0.53
95 0.53
96 0.52
97 0.56