Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3BBY8

Protein Details
Accession A0A0C3BBY8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
6-30QSIVLIRRTSRRTRRERRPIVEDSTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, cyto 3, cysk 3
Family & Domain DBs
Amino Acid Sequences MYPAAQSIVLIRRTSRRTRRERRPIVEDSTNACRFRFQIALPFMGNLPDVPFQIYDFVFWWEESVVSYGYITAFSRMSDFVDPFFA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.52
3 0.57
4 0.64
5 0.74
6 0.83
7 0.87
8 0.91
9 0.88
10 0.85
11 0.8
12 0.76
13 0.7
14 0.6
15 0.53
16 0.51
17 0.48
18 0.41
19 0.35
20 0.3
21 0.26
22 0.26
23 0.24
24 0.16
25 0.2
26 0.21
27 0.22
28 0.21
29 0.21
30 0.18
31 0.16
32 0.16
33 0.08
34 0.08
35 0.07
36 0.07
37 0.08
38 0.08
39 0.08
40 0.1
41 0.1
42 0.09
43 0.09
44 0.11
45 0.11
46 0.1
47 0.11
48 0.09
49 0.09
50 0.09
51 0.1
52 0.08
53 0.07
54 0.07
55 0.07
56 0.07
57 0.08
58 0.08
59 0.09
60 0.08
61 0.09
62 0.11
63 0.11
64 0.14
65 0.16
66 0.16