Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3FZR7

Protein Details
Accession A0A0C3FZR7    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
43-74SARTNTRHKRIRCKHMPKIRPKPRRIRNTETABasic
NLS Segment(s)
PositionSequence
49-69RHKRIRCKHMPKIRPKPRRIR
Subcellular Location(s) nucl 11, cyto_nucl 10.5, cyto 8, mito 7
Family & Domain DBs
Amino Acid Sequences MTQGLGYPFSAAHDTTNRLVCNVGDCTIGRKFKQDCGWYQVVSARTNTRHKRIRCKHMPKIRPKPRRIRNTETADRMPGKALVPSGCLFEADRIKRPKTLTCLQDMATFSVSGLKIFCRSGEVRRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.23
3 0.28
4 0.26
5 0.25
6 0.25
7 0.22
8 0.22
9 0.2
10 0.18
11 0.15
12 0.15
13 0.18
14 0.23
15 0.27
16 0.24
17 0.29
18 0.3
19 0.35
20 0.43
21 0.43
22 0.41
23 0.44
24 0.47
25 0.4
26 0.39
27 0.36
28 0.31
29 0.28
30 0.26
31 0.22
32 0.25
33 0.34
34 0.38
35 0.43
36 0.49
37 0.53
38 0.62
39 0.68
40 0.73
41 0.75
42 0.8
43 0.81
44 0.83
45 0.86
46 0.86
47 0.88
48 0.88
49 0.87
50 0.85
51 0.86
52 0.85
53 0.87
54 0.84
55 0.81
56 0.8
57 0.79
58 0.77
59 0.71
60 0.63
61 0.57
62 0.49
63 0.42
64 0.33
65 0.26
66 0.2
67 0.15
68 0.15
69 0.12
70 0.13
71 0.13
72 0.14
73 0.12
74 0.12
75 0.12
76 0.14
77 0.22
78 0.22
79 0.3
80 0.34
81 0.36
82 0.39
83 0.42
84 0.44
85 0.44
86 0.49
87 0.45
88 0.45
89 0.46
90 0.43
91 0.45
92 0.4
93 0.35
94 0.29
95 0.25
96 0.19
97 0.21
98 0.2
99 0.16
100 0.15
101 0.14
102 0.15
103 0.16
104 0.16
105 0.17
106 0.2