Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3B300

Protein Details
Accession A0A0C3B300    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
6-26YYEIEKRSRKIEKRNCQIEKQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto_nucl 13.333, mito_nucl 12.499
Family & Domain DBs
Amino Acid Sequences MTENGYYEIEKRSRKIEKRNCQIEKQICKGIAVDPPPNSKDMISRNLWISHPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.6
3 0.65
4 0.69
5 0.76
6 0.85
7 0.81
8 0.76
9 0.77
10 0.74
11 0.7
12 0.63
13 0.56
14 0.46
15 0.41
16 0.38
17 0.31
18 0.26
19 0.23
20 0.23
21 0.22
22 0.26
23 0.27
24 0.27
25 0.26
26 0.22
27 0.25
28 0.26
29 0.3
30 0.29
31 0.31
32 0.34
33 0.36