Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3ETW8

Protein Details
Accession A0A0C3ETW8    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
38-68EGKPKQDKTTEKRPNKKERQYEKQREQRWRTBasic
NLS Segment(s)
PositionSequence
31-62KEARRAEEGKPKQDKTTEKRPNKKERQYEKQR
Subcellular Location(s) nucl 19, cyto 5, mito 2
Family & Domain DBs
Amino Acid Sequences MSHRNKNQSEVIRGDECGDYCSVDLVRGMAKEARRAEEGKPKQDKTTEKRPNKKERQYEKQREQRWRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.32
3 0.25
4 0.21
5 0.18
6 0.13
7 0.11
8 0.12
9 0.1
10 0.08
11 0.08
12 0.07
13 0.08
14 0.07
15 0.09
16 0.1
17 0.11
18 0.16
19 0.17
20 0.19
21 0.2
22 0.22
23 0.24
24 0.32
25 0.36
26 0.39
27 0.46
28 0.45
29 0.46
30 0.51
31 0.56
32 0.53
33 0.6
34 0.61
35 0.64
36 0.73
37 0.8
38 0.85
39 0.87
40 0.9
41 0.9
42 0.89
43 0.9
44 0.92
45 0.93
46 0.92
47 0.92
48 0.91