Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3EK84

Protein Details
Accession A0A0C3EK84    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
6-30QSIILIRRTSRRTRRERRPIVEDSTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23.5, cyto_mito 14
Family & Domain DBs
Amino Acid Sequences MYPAAQSIILIRRTSRRTRRERRPIVEDSTNARRFRFQIALPFMGNLPGVPFQIHDFVFWWEESVVSYGYITAFSRMSDAWVLCASTGGDRSSSYFGVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.53
3 0.57
4 0.65
5 0.75
6 0.84
7 0.87
8 0.91
9 0.88
10 0.86
11 0.81
12 0.76
13 0.71
14 0.62
15 0.57
16 0.56
17 0.55
18 0.48
19 0.43
20 0.38
21 0.35
22 0.37
23 0.34
24 0.26
25 0.28
26 0.31
27 0.33
28 0.3
29 0.29
30 0.24
31 0.21
32 0.19
33 0.11
34 0.08
35 0.06
36 0.06
37 0.06
38 0.06
39 0.07
40 0.09
41 0.1
42 0.09
43 0.09
44 0.1
45 0.11
46 0.11
47 0.11
48 0.08
49 0.08
50 0.08
51 0.09
52 0.07
53 0.06
54 0.06
55 0.06
56 0.06
57 0.07
58 0.07
59 0.07
60 0.07
61 0.07
62 0.09
63 0.09
64 0.1
65 0.12
66 0.12
67 0.12
68 0.13
69 0.13
70 0.12
71 0.13
72 0.11
73 0.1
74 0.12
75 0.11
76 0.11
77 0.12
78 0.15
79 0.18