Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3FSI7

Protein Details
Accession A0A0C3FSI7    Localization Confidence Low Confidence Score 5.7
NoLS Segment(s)
PositionSequenceProtein Nature
43-63LARWKLSKWKHARDERLARLEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, cyto 7, extr 3, pero 3, nucl 2, cysk 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR024242  NCE101  
Gene Ontology GO:0009306  P:protein secretion  
Pfam View protein in Pfam  
PF11654  NCE101  
Amino Acid Sequences MPPVLLSRGLDPLLGMFTGILAYYLYETNPRTAPPADQRLSELARWKLSKWKHARDERLARLEAGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.09
3 0.05
4 0.05
5 0.05
6 0.05
7 0.04
8 0.03
9 0.03
10 0.04
11 0.05
12 0.05
13 0.08
14 0.09
15 0.11
16 0.11
17 0.11
18 0.13
19 0.14
20 0.17
21 0.2
22 0.27
23 0.26
24 0.26
25 0.27
26 0.28
27 0.29
28 0.28
29 0.28
30 0.23
31 0.27
32 0.28
33 0.28
34 0.33
35 0.36
36 0.44
37 0.48
38 0.55
39 0.6
40 0.69
41 0.77
42 0.79
43 0.84
44 0.83
45 0.8
46 0.71