Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3EWT0

Protein Details
Accession A0A0C3EWT0    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
6-33HTPARWWMSAKRKLKKGCRWLRFQSRRGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 13.833, nucl 13.5, mito 12, cyto_nucl 8.166
Family & Domain DBs
Amino Acid Sequences MSYLHHTPARWWMSAKRKLKKGCRWLRFQSRRGYSGVISNRLSRDNSIRQRLSLVLLKVVKARMIHYS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.61
3 0.6
4 0.65
5 0.73
6 0.8
7 0.82
8 0.83
9 0.84
10 0.81
11 0.81
12 0.81
13 0.84
14 0.82
15 0.78
16 0.76
17 0.7
18 0.64
19 0.57
20 0.5
21 0.39
22 0.37
23 0.34
24 0.29
25 0.26
26 0.26
27 0.26
28 0.26
29 0.27
30 0.22
31 0.25
32 0.31
33 0.37
34 0.44
35 0.44
36 0.42
37 0.43
38 0.42
39 0.4
40 0.35
41 0.28
42 0.26
43 0.26
44 0.27
45 0.28
46 0.28
47 0.27
48 0.23