Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3FJ38

Protein Details
Accession A0A0C3FJ38    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
6-29QSIVLVRRTSRRARRERRPVVEDSHydrophilic
NLS Segment(s)
PositionSequence
16-22RRARRER
Subcellular Location(s) mito 22, cyto 2.5, cyto_nucl 2
Family & Domain DBs
Amino Acid Sequences MYPAAQSIVLVRRTSRRARRERRPVVEDSTNVRAFRFQVALPFMGNLPDVPFQIHDFVFWWEENVVSYGYITAFSRMGDLVLIGMGIMRVDRAPSFFFLLRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.51
3 0.55
4 0.63
5 0.73
6 0.81
7 0.86
8 0.9
9 0.88
10 0.84
11 0.78
12 0.74
13 0.69
14 0.6
15 0.54
16 0.5
17 0.44
18 0.39
19 0.34
20 0.28
21 0.24
22 0.24
23 0.2
24 0.14
25 0.14
26 0.16
27 0.16
28 0.15
29 0.14
30 0.12
31 0.11
32 0.11
33 0.07
34 0.07
35 0.07
36 0.07
37 0.07
38 0.08
39 0.08
40 0.1
41 0.1
42 0.08
43 0.08
44 0.09
45 0.11
46 0.1
47 0.1
48 0.08
49 0.08
50 0.09
51 0.09
52 0.08
53 0.06
54 0.06
55 0.06
56 0.06
57 0.07
58 0.06
59 0.07
60 0.07
61 0.07
62 0.08
63 0.07
64 0.07
65 0.06
66 0.06
67 0.05
68 0.04
69 0.04
70 0.03
71 0.03
72 0.03
73 0.03
74 0.03
75 0.04
76 0.04
77 0.06
78 0.07
79 0.09
80 0.12
81 0.14
82 0.2