Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9DDJ8

Protein Details
Accession E9DDJ8   
Localization Confidence Medium
Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
108-141DVEKSRRRDKSERNGDSRRQSDREDKRKRDRDGEBasic
NLS Segment(s)
PositionSequence
73-79KSEKRNK
112-138SRRRDKSERNGDSRRQSDREDKRKRDR
Subcellular Location(s) nucl 17.5, cyto_nucl 14, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002483  PWI_dom  
Gene Ontology GO:0005634  C:nucleus  
GO:0004386  F:helicase activity  
GO:0006397  P:mRNA processing  
Pfam View protein in Pfam  
PF01480  PWI  
Amino Acid Sequences MDTRTYVSDSLLRLTGASDPTVIDFILATTSSAKSPTLLREKLEPFLDASAGDIESFVSELWSRAGLKGSAGKSEKRNKPDDGTKKRYRLVEMEDGTVDHPGLGPTIDVEKSRRRDKSERNGDSRRQSDREDKRKRDRDGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.15
4 0.14
5 0.12
6 0.11
7 0.12
8 0.13
9 0.11
10 0.08
11 0.07
12 0.06
13 0.07
14 0.07
15 0.06
16 0.07
17 0.08
18 0.09
19 0.1
20 0.1
21 0.1
22 0.12
23 0.19
24 0.26
25 0.27
26 0.28
27 0.34
28 0.36
29 0.38
30 0.37
31 0.3
32 0.23
33 0.22
34 0.2
35 0.13
36 0.12
37 0.09
38 0.08
39 0.07
40 0.06
41 0.05
42 0.05
43 0.05
44 0.04
45 0.04
46 0.04
47 0.04
48 0.05
49 0.06
50 0.06
51 0.07
52 0.08
53 0.08
54 0.08
55 0.13
56 0.13
57 0.17
58 0.18
59 0.21
60 0.27
61 0.37
62 0.42
63 0.43
64 0.47
65 0.45
66 0.49
67 0.55
68 0.59
69 0.59
70 0.63
71 0.65
72 0.65
73 0.67
74 0.64
75 0.57
76 0.5
77 0.47
78 0.46
79 0.4
80 0.36
81 0.32
82 0.3
83 0.27
84 0.23
85 0.17
86 0.08
87 0.06
88 0.05
89 0.05
90 0.05
91 0.04
92 0.05
93 0.08
94 0.09
95 0.1
96 0.14
97 0.22
98 0.29
99 0.37
100 0.42
101 0.48
102 0.57
103 0.66
104 0.74
105 0.77
106 0.79
107 0.8
108 0.82
109 0.82
110 0.82
111 0.78
112 0.75
113 0.67
114 0.64
115 0.66
116 0.69
117 0.72
118 0.73
119 0.77
120 0.8
121 0.86