Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3BLG6

Protein Details
Accession A0A0C3BLG6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
6-30QSIVLVRRTSRRTRRERRPIVEDLTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, cyto 6.5, cyto_nucl 4
Family & Domain DBs
Amino Acid Sequences MYPAAQSIVLVRRTSRRTRRERRPIVEDLTNACRFRFQIALPFMGNLPDVPFRIHDFVFWWEESVVSYGYITAFLRMSDDTIIARINRHGYYACRLGAIVLLPTSALNSLVP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.53
3 0.57
4 0.65
5 0.75
6 0.84
7 0.87
8 0.91
9 0.88
10 0.85
11 0.81
12 0.75
13 0.69
14 0.6
15 0.53
16 0.49
17 0.46
18 0.39
19 0.32
20 0.28
21 0.24
22 0.25
23 0.23
24 0.16
25 0.2
26 0.22
27 0.24
28 0.22
29 0.22
30 0.2
31 0.18
32 0.17
33 0.09
34 0.09
35 0.08
36 0.08
37 0.08
38 0.09
39 0.11
40 0.13
41 0.13
42 0.11
43 0.12
44 0.13
45 0.15
46 0.14
47 0.13
48 0.1
49 0.11
50 0.11
51 0.1
52 0.08
53 0.06
54 0.06
55 0.05
56 0.05
57 0.06
58 0.06
59 0.06
60 0.06
61 0.06
62 0.07
63 0.07
64 0.08
65 0.08
66 0.08
67 0.07
68 0.08
69 0.1
70 0.09
71 0.1
72 0.12
73 0.15
74 0.15
75 0.16
76 0.18
77 0.19
78 0.25
79 0.28
80 0.25
81 0.22
82 0.22
83 0.2
84 0.2
85 0.17
86 0.13
87 0.09
88 0.08
89 0.08
90 0.08
91 0.09
92 0.08