Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3BP76

Protein Details
Accession A0A0C3BP76    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
8-30IILVERTSRRTRRERRPVVEDSTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, cyto 4, cyto_nucl 3.833, cyto_pero 2.833
Family & Domain DBs
Amino Acid Sequences MYPAAQSIILVERTSRRTRRERRPVVEDSTNVRVFRFQVTLPFMGNLLDVPFQIRDFVFWWERNVVSYGYITAFSLMDDLGLRGMGIMRVNRGLSFFFLLRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.38
3 0.42
4 0.52
5 0.62
6 0.72
7 0.78
8 0.82
9 0.81
10 0.83
11 0.8
12 0.76
13 0.71
14 0.62
15 0.56
16 0.52
17 0.47
18 0.4
19 0.34
20 0.28
21 0.24
22 0.24
23 0.21
24 0.14
25 0.16
26 0.19
27 0.19
28 0.19
29 0.18
30 0.15
31 0.13
32 0.13
33 0.09
34 0.06
35 0.05
36 0.05
37 0.06
38 0.06
39 0.06
40 0.07
41 0.06
42 0.06
43 0.07
44 0.11
45 0.14
46 0.14
47 0.16
48 0.17
49 0.18
50 0.18
51 0.18
52 0.15
53 0.12
54 0.11
55 0.1
56 0.09
57 0.1
58 0.09
59 0.08
60 0.07
61 0.06
62 0.07
63 0.05
64 0.05
65 0.05
66 0.05
67 0.05
68 0.05
69 0.04
70 0.04
71 0.05
72 0.06
73 0.09
74 0.1
75 0.12
76 0.15
77 0.16
78 0.16
79 0.17
80 0.17
81 0.17
82 0.2