Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3G035

Protein Details
Accession A0A0C3G035    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
71-91IRSSPRRSRGFSLRRRDQNFTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 9.5, mito 8, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018824  Conidiation-specific_6  
Pfam View protein in Pfam  
PF10346  Con-6  
Amino Acid Sequences MFGRTRNQNTRRSIFHRRHKDNVAGGYKAALSNPNTTREGRKRAKMELRMMGRGNETHVPFMTKVKRTLGIRSSPRRSRGFSLRRRDQNFT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.75
3 0.78
4 0.77
5 0.79
6 0.77
7 0.75
8 0.7
9 0.69
10 0.62
11 0.52
12 0.44
13 0.37
14 0.32
15 0.25
16 0.2
17 0.15
18 0.12
19 0.18
20 0.2
21 0.23
22 0.25
23 0.26
24 0.34
25 0.37
26 0.44
27 0.44
28 0.49
29 0.48
30 0.53
31 0.6
32 0.58
33 0.56
34 0.54
35 0.51
36 0.47
37 0.45
38 0.38
39 0.32
40 0.26
41 0.24
42 0.21
43 0.19
44 0.17
45 0.16
46 0.18
47 0.17
48 0.23
49 0.27
50 0.26
51 0.28
52 0.3
53 0.36
54 0.36
55 0.42
56 0.42
57 0.45
58 0.51
59 0.58
60 0.64
61 0.65
62 0.71
63 0.68
64 0.68
65 0.66
66 0.68
67 0.69
68 0.69
69 0.72
70 0.75
71 0.81