Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3BFZ1

Protein Details
Accession A0A0C3BFZ1    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
61-80YLQRGLSRHLHKKKHYVPAIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, nucl 6, cyto_nucl 5
Family & Domain DBs
Amino Acid Sequences MACASYPLSKCSKCQLSRSKVHIAAHTITSQLRFQTVFILLFPSMSKARLEGTPQTLLRGYLQRGLSRHLHKKKHYVPAIPTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.6
3 0.61
4 0.68
5 0.72
6 0.71
7 0.66
8 0.64
9 0.57
10 0.51
11 0.44
12 0.38
13 0.32
14 0.25
15 0.2
16 0.19
17 0.17
18 0.13
19 0.12
20 0.11
21 0.1
22 0.11
23 0.12
24 0.1
25 0.09
26 0.11
27 0.09
28 0.09
29 0.09
30 0.09
31 0.09
32 0.09
33 0.09
34 0.08
35 0.1
36 0.11
37 0.14
38 0.15
39 0.18
40 0.23
41 0.23
42 0.24
43 0.23
44 0.22
45 0.22
46 0.23
47 0.2
48 0.21
49 0.24
50 0.25
51 0.26
52 0.3
53 0.35
54 0.4
55 0.49
56 0.53
57 0.6
58 0.63
59 0.73
60 0.77
61 0.8
62 0.79
63 0.76