Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3F3N0

Protein Details
Accession A0A0C3F3N0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
6-29QSIVLVRRTSRRARRERRPVVEDSHydrophilic
NLS Segment(s)
PositionSequence
16-22RRARRER
Subcellular Location(s) mito 22, cyto 4
Family & Domain DBs
Amino Acid Sequences MYPAAQSIVLVRRTSRRARRERRPVVEDSTNARRVRFQIALPFMGNIPGVPFQIHDFVFWWEESVVSYGYITAFSRMSDDTVIARINRHGYYARRPGAIVLLPTFALNSLVP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.51
3 0.56
4 0.63
5 0.73
6 0.82
7 0.86
8 0.9
9 0.89
10 0.85
11 0.79
12 0.74
13 0.69
14 0.61
15 0.56
16 0.53
17 0.51
18 0.46
19 0.41
20 0.37
21 0.34
22 0.37
23 0.32
24 0.26
25 0.27
26 0.29
27 0.3
28 0.28
29 0.26
30 0.2
31 0.19
32 0.17
33 0.09
34 0.08
35 0.07
36 0.07
37 0.06
38 0.07
39 0.07
40 0.1
41 0.1
42 0.09
43 0.09
44 0.1
45 0.11
46 0.1
47 0.1
48 0.07
49 0.07
50 0.07
51 0.08
52 0.07
53 0.06
54 0.06
55 0.05
56 0.05
57 0.06
58 0.06
59 0.06
60 0.06
61 0.06
62 0.08
63 0.08
64 0.09
65 0.09
66 0.09
67 0.09
68 0.1
69 0.12
70 0.11
71 0.12
72 0.13
73 0.17
74 0.16
75 0.18
76 0.21
77 0.24
78 0.33
79 0.41
80 0.42
81 0.39
82 0.39
83 0.38
84 0.38
85 0.35
86 0.29
87 0.21
88 0.19
89 0.18
90 0.18
91 0.17
92 0.13