Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3FHG8

Protein Details
Accession A0A0C3FHG8    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
2-22ACHPASKKKDTSKPQAAKGTKHydrophilic
NLS Segment(s)
PositionSequence
8-47KKKDTSKPQAAKGTKASAAASKSAKVGSADSQKPRPKPKP
Subcellular Location(s) nucl 15.5, cyto_nucl 10.5, mito 7, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MACHPASKKKDTSKPQAAKGTKASAAASKSAKVGSADSQKPRPKPKPAYKAETAAGDAEKLASAALMMLGGDKRQGQKGARGGNDDKVEANVDKDEDEDEEEEDEMGDQLKEYTGQDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.81
3 0.82
4 0.75
5 0.7
6 0.66
7 0.6
8 0.51
9 0.45
10 0.38
11 0.31
12 0.3
13 0.29
14 0.26
15 0.22
16 0.21
17 0.2
18 0.2
19 0.16
20 0.16
21 0.18
22 0.24
23 0.29
24 0.33
25 0.41
26 0.45
27 0.51
28 0.59
29 0.61
30 0.62
31 0.68
32 0.73
33 0.76
34 0.77
35 0.77
36 0.71
37 0.67
38 0.58
39 0.48
40 0.38
41 0.29
42 0.22
43 0.14
44 0.11
45 0.07
46 0.06
47 0.05
48 0.04
49 0.03
50 0.02
51 0.02
52 0.02
53 0.02
54 0.02
55 0.03
56 0.03
57 0.03
58 0.04
59 0.06
60 0.08
61 0.1
62 0.14
63 0.15
64 0.21
65 0.28
66 0.33
67 0.33
68 0.37
69 0.37
70 0.39
71 0.39
72 0.34
73 0.28
74 0.23
75 0.23
76 0.18
77 0.18
78 0.13
79 0.12
80 0.12
81 0.12
82 0.12
83 0.1
84 0.12
85 0.11
86 0.11
87 0.12
88 0.12
89 0.11
90 0.1
91 0.09
92 0.07
93 0.08
94 0.07
95 0.06
96 0.06
97 0.07
98 0.08