Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3FDX3

Protein Details
Accession A0A0C3FDX3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
56-75RSTLRFKCRHGKQACKSEQEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, extr 3
Family & Domain DBs
Amino Acid Sequences MKFHCKARQLVLPIPSAVTATQCTVDDGIIISGTSGANTTTGIRLLRFLIANIKGRSTLRFKCRHGKQACKSEQESISTIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.31
3 0.24
4 0.18
5 0.14
6 0.11
7 0.1
8 0.11
9 0.11
10 0.11
11 0.11
12 0.1
13 0.09
14 0.08
15 0.07
16 0.06
17 0.05
18 0.04
19 0.04
20 0.04
21 0.04
22 0.04
23 0.04
24 0.04
25 0.04
26 0.05
27 0.05
28 0.06
29 0.07
30 0.06
31 0.07
32 0.08
33 0.09
34 0.09
35 0.09
36 0.13
37 0.16
38 0.23
39 0.22
40 0.22
41 0.23
42 0.24
43 0.27
44 0.29
45 0.33
46 0.36
47 0.44
48 0.49
49 0.57
50 0.64
51 0.71
52 0.73
53 0.76
54 0.77
55 0.79
56 0.81
57 0.78
58 0.73
59 0.71
60 0.65
61 0.58