Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3F3T9

Protein Details
Accession A0A0C3F3T9    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
13-34ASTATPRPRGRPPKRVVKSSEFHydrophilic
NLS Segment(s)
PositionSequence
20-26PRGRPPK
Subcellular Location(s) mito 14, nucl 9.5, cyto_nucl 7, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MAPKKNPVAASEASTATPRPRGRPPKRVVKSSEFVDDEAEEVSSLSEDDDVRNVKSTTGTKGRPQPHPRAASRAKSVSDDDDTMSVKSATSAKECPRPRAVSRSKPVLEASDDDDAMSIKSVASTNNRSRSRPAAKAKSVRPVTDDDDITNNRFRSRPAAKAKSVRPTTDDDTIDISSGDDAMSVKSTKSVKSAMSIDDEEWPATPPSRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.26
3 0.23
4 0.29
5 0.28
6 0.3
7 0.4
8 0.5
9 0.59
10 0.68
11 0.73
12 0.76
13 0.81
14 0.84
15 0.81
16 0.78
17 0.73
18 0.66
19 0.65
20 0.55
21 0.47
22 0.41
23 0.33
24 0.25
25 0.2
26 0.17
27 0.09
28 0.08
29 0.07
30 0.05
31 0.05
32 0.05
33 0.06
34 0.06
35 0.07
36 0.1
37 0.12
38 0.12
39 0.15
40 0.15
41 0.15
42 0.18
43 0.2
44 0.23
45 0.29
46 0.31
47 0.35
48 0.43
49 0.49
50 0.55
51 0.61
52 0.63
53 0.65
54 0.69
55 0.65
56 0.66
57 0.66
58 0.61
59 0.59
60 0.53
61 0.45
62 0.4
63 0.4
64 0.33
65 0.29
66 0.24
67 0.19
68 0.17
69 0.17
70 0.15
71 0.14
72 0.11
73 0.08
74 0.09
75 0.1
76 0.1
77 0.12
78 0.16
79 0.18
80 0.27
81 0.29
82 0.33
83 0.36
84 0.4
85 0.4
86 0.46
87 0.51
88 0.51
89 0.54
90 0.57
91 0.52
92 0.49
93 0.47
94 0.38
95 0.31
96 0.24
97 0.22
98 0.15
99 0.14
100 0.13
101 0.12
102 0.1
103 0.09
104 0.08
105 0.05
106 0.03
107 0.04
108 0.05
109 0.07
110 0.11
111 0.18
112 0.24
113 0.34
114 0.36
115 0.37
116 0.4
117 0.47
118 0.5
119 0.52
120 0.55
121 0.54
122 0.6
123 0.66
124 0.66
125 0.67
126 0.63
127 0.55
128 0.48
129 0.43
130 0.4
131 0.36
132 0.33
133 0.24
134 0.27
135 0.28
136 0.28
137 0.28
138 0.25
139 0.23
140 0.23
141 0.23
142 0.27
143 0.31
144 0.38
145 0.43
146 0.5
147 0.55
148 0.62
149 0.67
150 0.68
151 0.67
152 0.6
153 0.52
154 0.51
155 0.49
156 0.48
157 0.43
158 0.34
159 0.33
160 0.31
161 0.28
162 0.22
163 0.17
164 0.11
165 0.1
166 0.08
167 0.05
168 0.05
169 0.06
170 0.08
171 0.09
172 0.09
173 0.14
174 0.16
175 0.17
176 0.21
177 0.23
178 0.22
179 0.27
180 0.3
181 0.27
182 0.31
183 0.31
184 0.29
185 0.3
186 0.3
187 0.25
188 0.23
189 0.23
190 0.19
191 0.21