Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3ABX8

Protein Details
Accession A0A0C3ABX8    Localization Confidence Low Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
65-88GCTKCSRCGKKGHNKSNKKCPKYSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, cyto 6, nucl 4
Family & Domain DBs
Amino Acid Sequences MPNAILKRIVDCAHAMKINSKEDLQLETQWSCANIYSEEILTLIKIHHAPPEPVPAGISGTEPAGCTKCSRCGKKGHNKSNKKCPKYSSPSEKENIPPVQSACSIFLGITRSISYIFFYT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.27
3 0.29
4 0.33
5 0.34
6 0.34
7 0.3
8 0.28
9 0.27
10 0.29
11 0.25
12 0.22
13 0.22
14 0.2
15 0.2
16 0.18
17 0.17
18 0.15
19 0.13
20 0.12
21 0.1
22 0.11
23 0.11
24 0.1
25 0.1
26 0.1
27 0.08
28 0.07
29 0.07
30 0.05
31 0.06
32 0.07
33 0.08
34 0.12
35 0.13
36 0.15
37 0.16
38 0.22
39 0.21
40 0.2
41 0.19
42 0.15
43 0.14
44 0.13
45 0.12
46 0.06
47 0.06
48 0.06
49 0.06
50 0.07
51 0.07
52 0.07
53 0.09
54 0.1
55 0.19
56 0.27
57 0.32
58 0.35
59 0.44
60 0.54
61 0.63
62 0.73
63 0.74
64 0.77
65 0.83
66 0.87
67 0.89
68 0.89
69 0.84
70 0.78
71 0.74
72 0.74
73 0.72
74 0.74
75 0.74
76 0.69
77 0.69
78 0.67
79 0.64
80 0.57
81 0.56
82 0.49
83 0.4
84 0.37
85 0.31
86 0.32
87 0.3
88 0.28
89 0.22
90 0.2
91 0.19
92 0.15
93 0.17
94 0.17
95 0.15
96 0.15
97 0.13
98 0.13
99 0.14
100 0.14