Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3AS44

Protein Details
Accession A0A0C3AS44    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
58-77GPGMQKRRIRKWSMRRQDTVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, extr 3
Family & Domain DBs
Amino Acid Sequences MRLLDRVLVFVVGVLRNRGGGGIVRGKGGGNSSVLYNAEYFWCSYLAYHLDAGIQKEGPGMQKRRIRKWSMRRQDTVPAQGIRTSEWGKSYHDGNIEAGCPGGST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.13
4 0.13
5 0.12
6 0.1
7 0.1
8 0.13
9 0.18
10 0.18
11 0.18
12 0.18
13 0.18
14 0.18
15 0.18
16 0.14
17 0.09
18 0.09
19 0.09
20 0.1
21 0.11
22 0.11
23 0.09
24 0.08
25 0.08
26 0.08
27 0.08
28 0.07
29 0.07
30 0.07
31 0.07
32 0.08
33 0.09
34 0.09
35 0.09
36 0.08
37 0.09
38 0.1
39 0.11
40 0.1
41 0.08
42 0.07
43 0.07
44 0.08
45 0.11
46 0.17
47 0.2
48 0.27
49 0.32
50 0.39
51 0.47
52 0.55
53 0.58
54 0.62
55 0.7
56 0.73
57 0.79
58 0.81
59 0.76
60 0.71
61 0.73
62 0.68
63 0.62
64 0.57
65 0.47
66 0.41
67 0.38
68 0.35
69 0.28
70 0.27
71 0.24
72 0.19
73 0.2
74 0.21
75 0.23
76 0.25
77 0.25
78 0.24
79 0.25
80 0.25
81 0.24
82 0.25
83 0.21
84 0.19
85 0.17