Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3F7N8

Protein Details
Accession A0A0C3F7N8    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
131-164QRYVKRKCGMRPPLRPWEKKKGWKHPAEREIVKFBasic
NLS Segment(s)
PositionSequence
141-156RPPLRPWEKKKGWKHP
Subcellular Location(s) nucl 12, cyto 10.5, cyto_mito 8, mito 4.5
Family & Domain DBs
Amino Acid Sequences QLRPDQSHLLPPLEKERAVPIWIINPKLTKTREEYPSELPKLNSQKLLHLCNEDLAEHSKGFELHSARGRWGKVSWREFGYHVCEFEHHLYTITAYRPHPIPISKMYVVVPDYLIAEREMLDETNFGSLGQRYVKRKCGMRPPLRPWEKKKGWKHPAEREIVKFMNGEGDGFIEEWNEEYIDRMT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.31
3 0.33
4 0.31
5 0.31
6 0.29
7 0.22
8 0.27
9 0.31
10 0.32
11 0.29
12 0.29
13 0.31
14 0.37
15 0.38
16 0.34
17 0.36
18 0.42
19 0.46
20 0.49
21 0.51
22 0.51
23 0.58
24 0.57
25 0.54
26 0.47
27 0.47
28 0.49
29 0.48
30 0.46
31 0.38
32 0.42
33 0.44
34 0.47
35 0.42
36 0.37
37 0.34
38 0.29
39 0.29
40 0.22
41 0.18
42 0.18
43 0.17
44 0.14
45 0.14
46 0.13
47 0.12
48 0.13
49 0.15
50 0.13
51 0.15
52 0.21
53 0.22
54 0.23
55 0.27
56 0.27
57 0.24
58 0.24
59 0.29
60 0.32
61 0.35
62 0.35
63 0.34
64 0.35
65 0.34
66 0.34
67 0.32
68 0.24
69 0.21
70 0.18
71 0.17
72 0.18
73 0.19
74 0.18
75 0.12
76 0.12
77 0.11
78 0.12
79 0.14
80 0.12
81 0.13
82 0.12
83 0.13
84 0.13
85 0.15
86 0.16
87 0.15
88 0.17
89 0.18
90 0.23
91 0.21
92 0.22
93 0.21
94 0.2
95 0.2
96 0.17
97 0.14
98 0.09
99 0.1
100 0.09
101 0.09
102 0.07
103 0.07
104 0.06
105 0.07
106 0.07
107 0.07
108 0.07
109 0.06
110 0.06
111 0.07
112 0.07
113 0.06
114 0.06
115 0.07
116 0.09
117 0.14
118 0.19
119 0.24
120 0.29
121 0.36
122 0.4
123 0.46
124 0.51
125 0.56
126 0.62
127 0.67
128 0.72
129 0.73
130 0.79
131 0.83
132 0.84
133 0.81
134 0.82
135 0.81
136 0.81
137 0.84
138 0.84
139 0.85
140 0.86
141 0.88
142 0.88
143 0.86
144 0.85
145 0.8
146 0.73
147 0.7
148 0.6
149 0.52
150 0.41
151 0.33
152 0.3
153 0.24
154 0.2
155 0.14
156 0.13
157 0.13
158 0.13
159 0.13
160 0.08
161 0.08
162 0.08
163 0.09
164 0.09
165 0.08