Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3G2K5

Protein Details
Accession A0A0C3G2K5    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MPVGSPKGFPRKRGRLPREFNSEKHydrophilic
NLS Segment(s)
PositionSequence
10-15PRKRGR
Subcellular Location(s) nucl 16, mito 7, cyto 4
Family & Domain DBs
Amino Acid Sequences MPVGSPKGFPRKRGRLPREFNSEKEVLAFKQEQVRKRRNLEKEQQSLGATTLETIKHFISKKFKQPLTVAALN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.8
3 0.85
4 0.85
5 0.84
6 0.77
7 0.69
8 0.64
9 0.55
10 0.44
11 0.38
12 0.31
13 0.21
14 0.22
15 0.2
16 0.15
17 0.22
18 0.26
19 0.31
20 0.38
21 0.46
22 0.47
23 0.53
24 0.6
25 0.61
26 0.65
27 0.69
28 0.7
29 0.68
30 0.63
31 0.59
32 0.51
33 0.43
34 0.35
35 0.25
36 0.16
37 0.11
38 0.11
39 0.09
40 0.09
41 0.11
42 0.1
43 0.16
44 0.18
45 0.24
46 0.32
47 0.38
48 0.48
49 0.56
50 0.58
51 0.59
52 0.6
53 0.62