Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3ETR7

Protein Details
Accession A0A0C3ETR7    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
243-264LEKQTWFKQKEPRPREKFDWFTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto 5, pero 1, E.R. 1, golg 1
Family & Domain DBs
Amino Acid Sequences MSFSTHFNPFLNLQLPAPVTEGTLPYPLIATRPSTPLPDDSAGSLMTISSPLSSLSADDNPLHDNKKPYPSINIEIMWNRVLQTNLKEDNVESPVSPLYVKDTLCPNRVGAWFMVRSGRLGRAYPSDETRLRSGVALRLEDRSISIHMLTDECPIHYIHLKKPIRRERGYVFYEFISDLYSHFRTPQPTKPPTNLIAIPIFHASDEAAHLNVQEATFHQQVLEEDYVIAPLRTWDKDPLTLSLEKQTWFKQKEPRPREKFDWFTSSEDNIRAEVAQILKAKESGSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.22
4 0.22
5 0.17
6 0.16
7 0.16
8 0.17
9 0.14
10 0.15
11 0.14
12 0.12
13 0.13
14 0.12
15 0.13
16 0.13
17 0.15
18 0.16
19 0.2
20 0.22
21 0.24
22 0.26
23 0.26
24 0.3
25 0.28
26 0.26
27 0.23
28 0.22
29 0.2
30 0.17
31 0.15
32 0.09
33 0.07
34 0.07
35 0.06
36 0.05
37 0.05
38 0.05
39 0.06
40 0.07
41 0.07
42 0.1
43 0.11
44 0.13
45 0.14
46 0.15
47 0.16
48 0.19
49 0.21
50 0.21
51 0.25
52 0.28
53 0.35
54 0.37
55 0.37
56 0.41
57 0.44
58 0.45
59 0.43
60 0.39
61 0.34
62 0.33
63 0.33
64 0.27
65 0.21
66 0.17
67 0.16
68 0.16
69 0.15
70 0.17
71 0.22
72 0.23
73 0.23
74 0.23
75 0.21
76 0.24
77 0.23
78 0.21
79 0.14
80 0.13
81 0.12
82 0.12
83 0.12
84 0.09
85 0.11
86 0.14
87 0.14
88 0.15
89 0.23
90 0.26
91 0.29
92 0.29
93 0.26
94 0.27
95 0.27
96 0.27
97 0.19
98 0.19
99 0.17
100 0.17
101 0.18
102 0.14
103 0.14
104 0.14
105 0.16
106 0.14
107 0.14
108 0.15
109 0.17
110 0.19
111 0.2
112 0.21
113 0.23
114 0.23
115 0.25
116 0.25
117 0.22
118 0.19
119 0.18
120 0.17
121 0.16
122 0.16
123 0.15
124 0.14
125 0.15
126 0.15
127 0.14
128 0.13
129 0.1
130 0.09
131 0.08
132 0.08
133 0.07
134 0.07
135 0.08
136 0.08
137 0.09
138 0.09
139 0.08
140 0.09
141 0.09
142 0.1
143 0.13
144 0.15
145 0.16
146 0.26
147 0.3
148 0.32
149 0.43
150 0.51
151 0.56
152 0.56
153 0.57
154 0.53
155 0.57
156 0.57
157 0.49
158 0.4
159 0.32
160 0.3
161 0.25
162 0.2
163 0.13
164 0.09
165 0.08
166 0.12
167 0.13
168 0.12
169 0.14
170 0.16
171 0.21
172 0.26
173 0.33
174 0.38
175 0.44
176 0.48
177 0.5
178 0.52
179 0.49
180 0.49
181 0.41
182 0.35
183 0.31
184 0.26
185 0.24
186 0.2
187 0.18
188 0.13
189 0.12
190 0.09
191 0.07
192 0.09
193 0.08
194 0.07
195 0.07
196 0.07
197 0.08
198 0.09
199 0.09
200 0.07
201 0.08
202 0.13
203 0.14
204 0.14
205 0.12
206 0.13
207 0.13
208 0.18
209 0.18
210 0.12
211 0.12
212 0.12
213 0.13
214 0.12
215 0.11
216 0.06
217 0.08
218 0.12
219 0.13
220 0.16
221 0.21
222 0.23
223 0.28
224 0.3
225 0.31
226 0.32
227 0.32
228 0.31
229 0.33
230 0.32
231 0.29
232 0.31
233 0.34
234 0.39
235 0.41
236 0.46
237 0.49
238 0.56
239 0.66
240 0.73
241 0.77
242 0.76
243 0.8
244 0.82
245 0.82
246 0.8
247 0.75
248 0.72
249 0.64
250 0.6
251 0.56
252 0.53
253 0.46
254 0.41
255 0.35
256 0.29
257 0.27
258 0.22
259 0.18
260 0.18
261 0.16
262 0.19
263 0.21
264 0.22
265 0.23
266 0.24