Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3F4L5

Protein Details
Accession A0A0C3F4L5    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
81-106GQMPILPRKKVDKKSKPKKSGSLFSSHydrophilic
NLS Segment(s)
PositionSequence
87-100PRKKVDKKSKPKKS
Subcellular Location(s) nucl 10.5cyto_nucl 10.5, mito 9, cyto 7.5
Family & Domain DBs
Amino Acid Sequences MNNNSTHPSTVSLQSTTTITSTTPLTSSKNDDSSTSVVKQPSMQKVEPSSVPSSSTVPLASQPKDFEAAFGKLSSSYGYGGQMPILPRKKVDKKSKPKKSGSLFSSGGEAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.23
3 0.2
4 0.17
5 0.13
6 0.1
7 0.11
8 0.11
9 0.11
10 0.11
11 0.12
12 0.14
13 0.16
14 0.22
15 0.24
16 0.27
17 0.27
18 0.26
19 0.28
20 0.28
21 0.29
22 0.25
23 0.24
24 0.21
25 0.21
26 0.24
27 0.27
28 0.31
29 0.33
30 0.32
31 0.31
32 0.32
33 0.34
34 0.31
35 0.29
36 0.24
37 0.19
38 0.19
39 0.17
40 0.17
41 0.15
42 0.14
43 0.11
44 0.09
45 0.12
46 0.15
47 0.15
48 0.15
49 0.15
50 0.15
51 0.18
52 0.17
53 0.15
54 0.15
55 0.15
56 0.14
57 0.14
58 0.13
59 0.11
60 0.12
61 0.11
62 0.08
63 0.08
64 0.08
65 0.09
66 0.09
67 0.09
68 0.09
69 0.11
70 0.12
71 0.2
72 0.24
73 0.24
74 0.26
75 0.36
76 0.45
77 0.53
78 0.63
79 0.66
80 0.72
81 0.83
82 0.91
83 0.91
84 0.9
85 0.9
86 0.88
87 0.87
88 0.79
89 0.76
90 0.66
91 0.57