Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3EFK6

Protein Details
Accession A0A0C3EFK6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
6-27QSIVLVKRTSRRTRCERRSMVEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22.5, cyto_mito 13, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MYTAAQSIVLVKRTSRRTRCERRSMVESSTNVHVLPFQLALPFMGNLPGVPFQIRDFVFWWEWNVVSYGYVTAFSCMGDLGLRDMGIMRVNRGPSFSFLLRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.5
3 0.56
4 0.64
5 0.74
6 0.82
7 0.85
8 0.82
9 0.79
10 0.77
11 0.71
12 0.65
13 0.61
14 0.51
15 0.44
16 0.39
17 0.32
18 0.26
19 0.22
20 0.18
21 0.12
22 0.12
23 0.09
24 0.07
25 0.07
26 0.07
27 0.07
28 0.07
29 0.07
30 0.06
31 0.06
32 0.05
33 0.05
34 0.06
35 0.06
36 0.06
37 0.06
38 0.07
39 0.06
40 0.11
41 0.12
42 0.12
43 0.12
44 0.15
45 0.16
46 0.16
47 0.17
48 0.13
49 0.13
50 0.12
51 0.12
52 0.09
53 0.08
54 0.08
55 0.07
56 0.06
57 0.07
58 0.07
59 0.07
60 0.07
61 0.06
62 0.06
63 0.06
64 0.06
65 0.05
66 0.05
67 0.07
68 0.07
69 0.07
70 0.07
71 0.08
72 0.08
73 0.13
74 0.13
75 0.14
76 0.18
77 0.21
78 0.21
79 0.23
80 0.24
81 0.23
82 0.29