Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3BNQ8

Protein Details
Accession A0A0C3BNQ8    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
76-102RGTEYQPSQRKRKRKHGFLARKRSPGGBasic
NLS Segment(s)
PositionSequence
85-114RKRKRKHGFLARKRSPGGRRVLARRLAKGR
Subcellular Location(s) mito 13, nucl 11.5, cyto_nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MPRIPRQLVQLLAHPPRLHPLPSRISHSVQSSAPALFALPSVRLPPITSTLALATPPHWSSSPILTCLQQTRYRARGTEYQPSQRKRKRKHGFLARKRSPGGRRVLARRLAKGRTFLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.36
3 0.37
4 0.37
5 0.35
6 0.31
7 0.34
8 0.38
9 0.41
10 0.47
11 0.45
12 0.45
13 0.46
14 0.44
15 0.4
16 0.32
17 0.31
18 0.25
19 0.21
20 0.18
21 0.14
22 0.11
23 0.08
24 0.08
25 0.07
26 0.06
27 0.07
28 0.08
29 0.08
30 0.08
31 0.09
32 0.1
33 0.13
34 0.13
35 0.13
36 0.13
37 0.13
38 0.13
39 0.12
40 0.11
41 0.08
42 0.09
43 0.09
44 0.1
45 0.09
46 0.11
47 0.12
48 0.16
49 0.16
50 0.16
51 0.17
52 0.16
53 0.17
54 0.19
55 0.22
56 0.21
57 0.24
58 0.27
59 0.3
60 0.31
61 0.31
62 0.32
63 0.36
64 0.36
65 0.43
66 0.42
67 0.48
68 0.55
69 0.6
70 0.67
71 0.67
72 0.73
73 0.72
74 0.79
75 0.8
76 0.82
77 0.87
78 0.87
79 0.91
80 0.91
81 0.93
82 0.9
83 0.85
84 0.78
85 0.76
86 0.7
87 0.66
88 0.64
89 0.61
90 0.61
91 0.62
92 0.68
93 0.68
94 0.67
95 0.68
96 0.67
97 0.66
98 0.61
99 0.6