Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3C4Z6

Protein Details
Accession A0A0C3C4Z6    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
72-101LGSRADTCRKRDRMRRCKHQVVKTKSTPPYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 13.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MMTIPSSHSRGRLKGCDSSCELMTHPSIHSRGAVGGGVNLLLSTRLLRRNRDRENVHSHFETLDVNGESDKLGSRADTCRKRDRMRRCKHQVVKTKSTPPYAPRIM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.52
3 0.51
4 0.5
5 0.48
6 0.42
7 0.36
8 0.32
9 0.26
10 0.26
11 0.22
12 0.18
13 0.19
14 0.18
15 0.18
16 0.17
17 0.15
18 0.14
19 0.13
20 0.12
21 0.08
22 0.07
23 0.07
24 0.06
25 0.05
26 0.04
27 0.04
28 0.03
29 0.03
30 0.04
31 0.07
32 0.14
33 0.17
34 0.24
35 0.33
36 0.42
37 0.48
38 0.56
39 0.57
40 0.56
41 0.63
42 0.6
43 0.55
44 0.46
45 0.4
46 0.32
47 0.28
48 0.22
49 0.13
50 0.12
51 0.09
52 0.08
53 0.08
54 0.08
55 0.07
56 0.07
57 0.08
58 0.06
59 0.06
60 0.06
61 0.09
62 0.15
63 0.25
64 0.33
65 0.39
66 0.48
67 0.57
68 0.66
69 0.73
70 0.77
71 0.79
72 0.82
73 0.87
74 0.87
75 0.89
76 0.9
77 0.9
78 0.9
79 0.88
80 0.87
81 0.84
82 0.84
83 0.78
84 0.75
85 0.7
86 0.64