Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3F5N6

Protein Details
Accession A0A0C3F5N6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
6-27QSIVLVKRTTRRTRCERRSVVEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, cyto 2
Family & Domain DBs
Amino Acid Sequences MYPAAQSIVLVKRTTRRTRCERRSVVEESTDVRVLPFQLALPFMGNLPGVPFQIRDFVFWWEWNVILYGYVTAFLHMGDGTIIAWVKRYGYYASQPGAIVLLPTAALNSLVP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.52
3 0.56
4 0.64
5 0.74
6 0.82
7 0.85
8 0.83
9 0.79
10 0.78
11 0.73
12 0.66
13 0.57
14 0.48
15 0.4
16 0.35
17 0.29
18 0.22
19 0.17
20 0.15
21 0.13
22 0.12
23 0.1
24 0.07
25 0.07
26 0.08
27 0.08
28 0.08
29 0.08
30 0.07
31 0.07
32 0.07
33 0.06
34 0.06
35 0.07
36 0.06
37 0.07
38 0.07
39 0.07
40 0.12
41 0.12
42 0.12
43 0.12
44 0.15
45 0.15
46 0.15
47 0.16
48 0.12
49 0.11
50 0.1
51 0.1
52 0.07
53 0.06
54 0.06
55 0.05
56 0.05
57 0.05
58 0.05
59 0.05
60 0.05
61 0.04
62 0.05
63 0.04
64 0.05
65 0.04
66 0.04
67 0.04
68 0.05
69 0.05
70 0.05
71 0.06
72 0.06
73 0.08
74 0.08
75 0.1
76 0.12
77 0.15
78 0.21
79 0.24
80 0.25
81 0.26
82 0.25
83 0.23
84 0.21
85 0.17
86 0.12
87 0.08
88 0.07
89 0.05
90 0.05
91 0.05
92 0.05