Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3BT40

Protein Details
Accession A0A0C3BT40    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
45-75QEPQGVRLRRKQKRKAKNRNGKRLTTKPLEMHydrophilic
NLS Segment(s)
PositionSequence
51-67RLRRKQKRKAKNRNGKR
Subcellular Location(s) nucl 15.5, cyto_nucl 10.5, mito 6, cyto 4.5
Family & Domain DBs
Amino Acid Sequences EAMNVLSSAPLAEAFSGTRKDRSIYAPVSQLLRLAPPFRYRLHHQEPQGVRLRRKQKRKAKNRNGKRLTTKPLEMIMI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.1
3 0.14
4 0.16
5 0.18
6 0.19
7 0.2
8 0.22
9 0.25
10 0.29
11 0.27
12 0.28
13 0.28
14 0.29
15 0.29
16 0.26
17 0.23
18 0.16
19 0.15
20 0.14
21 0.12
22 0.13
23 0.14
24 0.17
25 0.18
26 0.22
27 0.25
28 0.33
29 0.39
30 0.42
31 0.41
32 0.47
33 0.47
34 0.49
35 0.54
36 0.5
37 0.46
38 0.49
39 0.58
40 0.58
41 0.68
42 0.72
43 0.73
44 0.8
45 0.88
46 0.91
47 0.91
48 0.94
49 0.94
50 0.95
51 0.92
52 0.91
53 0.89
54 0.87
55 0.84
56 0.8
57 0.73
58 0.65